PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0054s0420.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NF-YB
Protein Properties Length: 190aa    MW: 19617.7 Da    PI: 6.6298
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0054s0420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1871.4e-5820115297
                   NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                             +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+
  SapurV1A.0054s0420.1.p  20 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQ 106
                             89************************************************************************************* PP

                   NF-YB  89 kyrelegek 97 
                             kyre+eg+k
  SapurV1A.0054s0420.1.p 107 KYREMEGDK 115
                             *******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5516126IPR009072Histone-fold
SuperFamilySSF471131.71E-4122125IPR009072Histone-fold
PfamPF008085.2E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.1E-225371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.1E-227290No hitNo description
PRINTSPR006157.1E-2291109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MADSDNESGG HNAASELSAK EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEEYVEP LKIYLQKYRE MEGDKSSMGR  120
PAGEKDGPGG GSGGSGAAGG GGGANSTGGG GGAFNGGGGG QGMYGGMMMM GHHHQGHVYG  180
AGGFHHQGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-5020110292Transcription factor HapC (Eurofung)
4g92_B9e-5020110292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644567.15e-92PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_003634760.15e-92PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233109e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG55e-92D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-74nuclear factor Y, subunit B3